HCM (RNMT) Rabbit Polyclonal Antibody TA345859 from OriGene Technologies | Biocompare.com

Supplier Images

HCM (RNMT) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
HCM (RNMT) Rabbit Polyclonal Antibody

The HCM (RNMT) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to RNMT. This antibody recognizes Human antigen. The HCM (RNMT) Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-RNMT Antibody

Product Specs
ItemHCM (RNMT) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA345859
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetRNMT
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-RNMT antibody: synthetic peptide directed towards the N terminal of human RNMT. Synthetic peptide located within the following region: ETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKNLEEGHSSTVAAHYNELQ
NCBI Full Gene NameRNA guanine-7 methyltransferase
NCBI Gene Aliasescm1p, Met, CMT1c, MET, RG7MT1, hCMT1, CMT1, hMet
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!